PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00056943-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family bZIP
Protein Properties Length: 126aa    MW: 15067.4 Da    PI: 10.6389
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00056943-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1254.2e-0830651045
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45
                      ++kN e+ +rsR RK++  +eL+  +  L aeNk++
  PSME_00056943-RA 30 MEKNGESVKRSRVRKQQHFDELRAHMVHLMAENKEY 65
                      89*******************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579594.15E-53065No hitNo description
Gene3DG3DSA:1.20.5.1705.3E-63064No hitNo description
SuperFamilySSF579593.02E-558106No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MFSNIESAKR SQLRKQQHLD ELRAQMVHLM EKNGESVKRS RVRKQQHFDE LRAHMVHLMA  60
ENKEYAMRSR IQKQQNLDEL TAQKVHIIVE NREILKKRNV ASKHYVHITE DNFLLISKVV  120
ELSQKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.11e-11basic leucine-zipper 44